Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NPM1 monoclonal antibody (M01), clone 3B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about NPM1 monoclonal antibody (M01), clone 3B2
| Brand: | Abnova |
| Reference: | H00004869-M01 |
| Product name: | NPM1 monoclonal antibody (M01), clone 3B2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NPM1. |
| Clone: | 3B2 |
| Isotype: | IgG1 kappa |
| Gene id: | 4869 |
| Gene name: | NPM1 |
| Gene alias: | B23|MGC104254|NPM |
| Gene description: | nucleophosmin (nucleolar phosphoprotein B23, numatrin) |
| Genbank accession: | BC002398 |
| Immunogen: | NPM1 (AAH02398.1, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL |
| Protein accession: | AAH02398.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (58.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to NPM1 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. [antibody concentration 5 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Retinoic acid and arsenic trioxide trigger degradation of mutated NPM-1 resulting in apoptosis of AML cells.El Hajj H, Dassouki Z, Berthier C, Raffoux E, Ades L, Legrand O, Hleihel R, Sahin U, Tawil N, Salameh A, Zibara K, Darwiche N, Mohty M, Dombret H, Fenaux P, de The H, Bazarbachi A Blood. 2015 Mar 23. pii: blood-2014-11-612416. |