Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NPC1 monoclonal antibody (M02), clone 4H2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about NPC1 monoclonal antibody (M02), clone 4H2
| Brand: | Abnova |
| Reference: | H00004864-M02 |
| Product name: | NPC1 monoclonal antibody (M02), clone 4H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NPC1. |
| Clone: | 4H2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4864 |
| Gene name: | NPC1 |
| Gene alias: | NPC |
| Gene description: | Niemann-Pick disease, type C1 |
| Genbank accession: | BC063302 |
| Immunogen: | NPC1 (AAH63302, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK |
| Protein accession: | AAH63302 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NPC1 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | NADH-cytochrome b5 reductase 3 promotes colonization and metastasis formation and is a prognostic marker of disease-free and overall survival in estrogen receptor-negative breast cancer.Lund RR, Leth-Larsen R, Caterino TD, Terp MG, Nissen J, Laenkholm AV, Jensen ON, Ditzel HJ. Mol Cell Proteomics. 2015 Sep 8. [Epub ahead of print] |