Brand: | Abnova |
Reference: | H00004862-M04 |
Product name: | NPAS2 monoclonal antibody (M04), clone 3B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NPAS2. |
Clone: | 3B1 |
Isotype: | IgG2a Kappa |
Gene id: | 4862 |
Gene name: | NPAS2 |
Gene alias: | FLJ23138|MGC71151|MOP4|PASD4|bHLHe9 |
Gene description: | neuronal PAS domain protein 2 |
Genbank accession: | NM_002518 |
Immunogen: | NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH |
Protein accession: | NP_002509 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.97 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |