| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00004862-M03A |
| Product name: | NPAS2 monoclonal antibody (M03A), clone 6C9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NPAS2. |
| Clone: | 6C9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4862 |
| Gene name: | NPAS2 |
| Gene alias: | FLJ23138|MGC71151|MOP4|PASD4|bHLHe9 |
| Gene description: | neuronal PAS domain protein 2 |
| Genbank accession: | NM_002518 |
| Immunogen: | NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH |
| Protein accession: | NP_002509 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.97 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NPAS2 expression in transfected 293T cell line by NPAS2 monoclonal antibody (M03A), clone 6C9. Lane 1: NPAS2 transfected lysate(91.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |