NPAS2 monoclonal antibody (M03), clone 6C9 View larger

NPAS2 monoclonal antibody (M03), clone 6C9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NPAS2 monoclonal antibody (M03), clone 6C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about NPAS2 monoclonal antibody (M03), clone 6C9

Brand: Abnova
Reference: H00004862-M03
Product name: NPAS2 monoclonal antibody (M03), clone 6C9
Product description: Mouse monoclonal antibody raised against a partial recombinant NPAS2.
Clone: 6C9
Isotype: IgG2a Kappa
Gene id: 4862
Gene name: NPAS2
Gene alias: FLJ23138|MGC71151|MOP4|PASD4|bHLHe9
Gene description: neuronal PAS domain protein 2
Genbank accession: NM_002518
Immunogen: NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH
Protein accession: NP_002509
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004862-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004862-M03-13-15-1.jpg
Application image note: Western Blot analysis of NPAS2 expression in transfected 293T cell line by NPAS2 monoclonal antibody (M03), clone 6C9.

Lane 1: NPAS2 transfected lysate(91.8 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NPAS2 monoclonal antibody (M03), clone 6C9 now

Add to cart