| Brand: | Abnova |
| Reference: | H00004857-M10 |
| Product name: | NOVA1 monoclonal antibody (M10), clone 5D9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NOVA1. |
| Clone: | 5D9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4857 |
| Gene name: | NOVA1 |
| Gene alias: | Nova-1 |
| Gene description: | neuro-oncological ventral antigen 1 |
| Genbank accession: | NM_002515 |
| Immunogen: | NOVA1 (NP_002506, 408 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG |
| Protein accession: | NP_002506 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | NOVA1 monoclonal antibody (M10), clone 5D9. Western Blot analysis of NOVA1 expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | RBM4âNova1âSRSF6 splicing cascade modulates the development of brown adipocytes.Lin JC, Chi YL, Peng HY, Lu LH. Biochimica et Biophysica Acta (BBA) - Gene Regulatory Mechanisms. 2016 Aug 12. [Epub ahead of print] |