View larger

NOV monoclonal antibody (M02), clone 2G8

Reference:

Condition: New product

Data sheet of NOV monoclonal antibody (M02), clone 2G8

Brand:	Abnova
Reference:	H00004856-M02
Product name:	NOV monoclonal antibody (M02), clone 2G8
Product description:	Mouse monoclonal antibody raised against a partial recombinant NOV.
Clone:	2G8
Isotype:	IgG2a Kappa
Gene id:	4856
Gene name:	NOV
Gene alias:	CCN3\|IGFBP9
Gene description:	nephroblastoma overexpressed gene
Genbank accession:	NM_002514
Immunogen:	NOV (NP_002505.1, 32 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQC
Protein accession:	NP_002505.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.63 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of NOV expression in transfected 293T cell line by NOV monoclonal antibody (M02), clone 2G8. Lane 1: NOV transfected lysate(39.2 KDa). Lane 2: Non-transfected lysate.
Applications:	ELISA,WB-Re,WB-Tr,IP
Shipping condition:	Dry Ice