NOV monoclonal antibody (M01), clone 3C2 View larger

NOV monoclonal antibody (M01), clone 3C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NOV monoclonal antibody (M01), clone 3C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about NOV monoclonal antibody (M01), clone 3C2

Brand: Abnova
Reference: H00004856-M01
Product name: NOV monoclonal antibody (M01), clone 3C2
Product description: Mouse monoclonal antibody raised against a full-length recombinant NOV.
Clone: 3C2
Isotype: IgG2a Kappa
Gene id: 4856
Gene name: NOV
Gene alias: CCN3|IGFBP9
Gene description: nephroblastoma overexpressed gene
Genbank accession: BC015028
Immunogen: NOV (AAH15028, 1 a.a. ~ 357 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDEGSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Protein accession: AAH15028
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004856-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (65.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004856-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged NOV is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NOV monoclonal antibody (M01), clone 3C2 now

Add to cart