Brand: | Abnova |
Reference: | H00004854-M01A |
Product name: | NOTCH3 monoclonal antibody (M01A), clone 1G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NOTCH3. |
Clone: | 1G5 |
Isotype: | IgG2a Kappa |
Gene id: | 4854 |
Gene name: | NOTCH3 |
Gene alias: | CADASIL|CASIL |
Gene description: | Notch homolog 3 (Drosophila) |
Genbank accession: | NM_000435 |
Immunogen: | NOTCH3 (NP_000426, 47 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR |
Protein accession: | NP_000426 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |