NPY monoclonal antibody (M06), clone 3H2 View larger

NPY monoclonal antibody (M06), clone 3H2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NPY monoclonal antibody (M06), clone 3H2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NPY monoclonal antibody (M06), clone 3H2

Brand: Abnova
Reference: H00004852-M06
Product name: NPY monoclonal antibody (M06), clone 3H2
Product description: Mouse monoclonal antibody raised against a partial recombinant NPY.
Clone: 3H2
Isotype: IgG1 Kappa
Gene id: 4852
Gene name: NPY
Gene alias: PYY4
Gene description: neuropeptide Y
Genbank accession: BC029497
Immunogen: NPY (AAH29497, 29 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Protein accession: AAH29497
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004852-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004852-M06-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged NPY is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NPY monoclonal antibody (M06), clone 3H2 now

Add to cart