Brand: | Abnova |
Reference: | H00004852-M04 |
Product name: | NPY monoclonal antibody (M04), clone 3F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NPY. |
Clone: | 3F8 |
Isotype: | IgG1 Kappa |
Gene id: | 4852 |
Gene name: | NPY |
Gene alias: | PYY4 |
Gene description: | neuropeptide Y |
Genbank accession: | BC029497 |
Immunogen: | NPY (AAH29497, 29 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW |
Protein accession: | AAH29497 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NPY is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |