Brand: | Abnova |
Reference: | H00004851-M10 |
Product name: | NOTCH1 monoclonal antibody (M10), clone 4G1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NOTCH1. |
Clone: | 4G1 |
Isotype: | IgG1 Kappa |
Gene id: | 4851 |
Gene name: | NOTCH1 |
Gene alias: | TAN1|hN1 |
Gene description: | Notch homolog 1, translocation-associated (Drosophila) |
Genbank accession: | NM_017617 |
Immunogen: | NOTCH1 (NP_060087, 23 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPG |
Protein accession: | NP_060087 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | NOTCH1 monoclonal antibody (M10), clone 4G1. Western Blot analysis of NOTCH1 expression in Raw 264.7(Cat # L024V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |