Cart 2 Product Products 764,00 € (empty)
No products
To be determined Shipping
764,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 764,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 764,00 €
Data sheet of NOTCH1 monoclonal antibody (M10), clone 4G1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA |
More info about NOTCH1 monoclonal antibody (M10), clone 4G1
| Brand: | Abnova |
| Reference: | H00004851-M10 |
| Product name: | NOTCH1 monoclonal antibody (M10), clone 4G1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NOTCH1. |
| Clone: | 4G1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4851 |
| Gene name: | NOTCH1 |
| Gene alias: | TAN1|hN1 |
| Gene description: | Notch homolog 1, translocation-associated (Drosophila) |
| Genbank accession: | NM_017617 |
| Immunogen: | NOTCH1 (NP_060087, 23 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPG |
| Protein accession: | NP_060087 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | NOTCH1 monoclonal antibody (M10), clone 4G1. Western Blot analysis of NOTCH1 expression in Raw 264.7(Cat # L024V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |