Brand: | Abnova |
Reference: | H00004833-M02 |
Product name: | NME4 monoclonal antibody (M02), clone 4B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NME4. |
Clone: | 4B6 |
Isotype: | IgG2b Kappa |
Gene id: | 4833 |
Gene name: | NME4 |
Gene alias: | NDPK-D|NM23H4|nm23-H4 |
Gene description: | non-metastatic cells 4, protein expressed in |
Genbank accession: | NM_005009.2 |
Immunogen: | NME4 (NP_005000.1, 99 a.a. ~ 187 a.a) partial recombinant protein with GST-pstS1 tag. |
Immunogen sequence/protein sequence: | RYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA |
Protein accession: | NP_005000.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NME4 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |