Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NME4 monoclonal antibody (M02), clone 4B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about NME4 monoclonal antibody (M02), clone 4B6
| Brand: | Abnova |
| Reference: | H00004833-M02 |
| Product name: | NME4 monoclonal antibody (M02), clone 4B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NME4. |
| Clone: | 4B6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4833 |
| Gene name: | NME4 |
| Gene alias: | NDPK-D|NM23H4|nm23-H4 |
| Gene description: | non-metastatic cells 4, protein expressed in |
| Genbank accession: | NM_005009.2 |
| Immunogen: | NME4 (NP_005000.1, 99 a.a. ~ 187 a.a) partial recombinant protein with GST-pstS1 tag. |
| Immunogen sequence/protein sequence: | RYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA |
| Protein accession: | NP_005000.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NME4 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |