No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00004832-M13 |
| Product name: | NME3 monoclonal antibody (M13), clone 3G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NME3. |
| Clone: | 3G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4832 |
| Gene name: | NME3 |
| Gene alias: | DR-nm23|KIAA0516|NDPK-C|NDPKC|NM23-H3|c371H6.2 |
| Gene description: | non-metastatic cells 3, protein expressed in |
| Genbank accession: | NM_002513 |
| Immunogen: | NME3 (NP_002504.2, 73 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE |
| Protein accession: | NP_002504.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NME3 expression in transfected 293T cell line by NME3 monoclonal antibody (M13), clone 3G10. Lane 1: NME3 transfected lysate(19 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |