Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00004832-M13 |
Product name: | NME3 monoclonal antibody (M13), clone 3G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NME3. |
Clone: | 3G10 |
Isotype: | IgG2a Kappa |
Gene id: | 4832 |
Gene name: | NME3 |
Gene alias: | DR-nm23|KIAA0516|NDPK-C|NDPKC|NM23-H3|c371H6.2 |
Gene description: | non-metastatic cells 3, protein expressed in |
Genbank accession: | NM_002513 |
Immunogen: | NME3 (NP_002504.2, 73 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE |
Protein accession: | NP_002504.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NME3 expression in transfected 293T cell line by NME3 monoclonal antibody (M13), clone 3G10. Lane 1: NME3 transfected lysate(19 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |