Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00004831-M12 |
Product name: | NME2 monoclonal antibody (M12), clone 4A7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant NME2. |
Clone: | 4A7 |
Isotype: | IgG2b Kappa |
Gene id: | 4831 |
Gene name: | NME2 |
Gene alias: | MGC111212|NDPK-B|NDPKB|NM23-H2|NM23B|puf |
Gene description: | non-metastatic cells 2, protein (NM23B) expressed in |
Genbank accession: | BC002476 |
Immunogen: | NME2 (AAH02476, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
Protein accession: | AAH02476 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (42.46 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NME2 expression in transfected 293T cell line by NME2 monoclonal antibody (M12), clone 4A7. Lane 1: NME2 transfected lysate(17.298 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |