NME2 monoclonal antibody (M09), clone 1A9 View larger

NME2 monoclonal antibody (M09), clone 1A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NME2 monoclonal antibody (M09), clone 1A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about NME2 monoclonal antibody (M09), clone 1A9

Brand: Abnova
Reference: H00004831-M09
Product name: NME2 monoclonal antibody (M09), clone 1A9
Product description: Mouse monoclonal antibody raised against a partial recombinant NME2.
Clone: 1A9
Isotype: IgG3 Kappa
Gene id: 4831
Gene name: NME2
Gene alias: MGC111212|NDPK-B|NDPKB|NM23-H2|NM23B|puf
Gene description: non-metastatic cells 2, protein (NM23B) expressed in
Genbank accession: NM_002512
Immunogen: NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Protein accession: NP_002503
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004831-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.96 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00004831-M09-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NME2 monoclonal antibody (M09), clone 1A9 now

Add to cart