Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NME2 monoclonal antibody (M01), clone 4B7-3F12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about NME2 monoclonal antibody (M01), clone 4B7-3F12
| Brand: | Abnova |
| Reference: | H00004831-M01 |
| Product name: | NME2 monoclonal antibody (M01), clone 4B7-3F12 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NME2. |
| Clone: | 4B7-3F12 |
| Isotype: | IgG1 kappa |
| Gene id: | 4831 |
| Gene name: | NME2 |
| Gene alias: | MGC111212|NDPK-B|NDPKB|NM23-H2|NM23B|puf |
| Gene description: | non-metastatic cells 2, protein (NM23B) expressed in |
| Genbank accession: | BC002476 |
| Immunogen: | NME2 (AAH02476, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
| Protein accession: | AAH02476 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.46 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NME2 monoclonal antibody (M01), clone 4B7-3F12 Western Blot analysis of NME2 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |