| Brand: | Abnova |
| Reference: | H00004830-M02 |
| Product name: | NME1 monoclonal antibody (M02), clone 1D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NME1. |
| Clone: | 1D7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4830 |
| Gene name: | NME1 |
| Gene alias: | AWD|GAAD|NB|NBS|NDPK-A|NDPKA|NM23|NM23-H1 |
| Gene description: | non-metastatic cells 1, protein (NM23A) expressed in |
| Genbank accession: | NM_000269 |
| Immunogen: | NME1 (NP_000260, 43 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE |
| Protein accession: | NP_000260 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Identification of Antigenic Proteins Associated with Trichloroethylene-Induced Autoimmune Disease by Serological Proteome Analysis.Liu J, Xing X, Huang H, Jiang Y, He H, Xu X, Yuan J, Zhou L, Yang L, Zhuang Z. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):393-400. Epub 2009 Aug 6. |