Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00004830-D01P |
Product name: | NME1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human NME1 protein. |
Gene id: | 4830 |
Gene name: | NME1 |
Gene alias: | AWD|GAAD|NB|NBS|NDPK-A|NDPKA|NM23|NM23-H1 |
Gene description: | non-metastatic cells 1, protein (NM23A) expressed in |
Genbank accession: | NM_198175 |
Immunogen: | NME1 (ENSP00000337060, 1 a.a. ~ 177 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE |
Protein accession: | ENSP00000337060 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NME1 expression in transfected 293T cell line (H00004830-T01) by NME1 MaxPab polyclonal antibody. Lane 1: NME1 transfected lysate(19.70 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |