Brand: | Abnova |
Reference: | H00004826-M01 |
Product name: | NNAT monoclonal antibody (M01), clone 1B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NNAT. |
Clone: | 1B9 |
Isotype: | IgG2a Kappa |
Gene id: | 4826 |
Gene name: | NNAT |
Gene alias: | MGC1439|Peg5 |
Gene description: | neuronatin |
Genbank accession: | NM_005386 |
Immunogen: | NNAT (NP_005377.1, 22 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN |
Protein accession: | NP_005377.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NNAT is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |