Brand: | Abnova |
Reference: | H00004825-M01 |
Product name: | NKX6-1 monoclonal antibody (M01), clone 1B7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant NKX6-1. |
Clone: | 1B7 |
Isotype: | IgG2a Kappa |
Gene id: | 4825 |
Gene name: | NKX6-1 |
Gene alias: | NKX6.1|NKX6A |
Gene description: | NK6 homeobox 1 |
Genbank accession: | NM_006168 |
Immunogen: | NKX6-1 (NP_006159, 191 a.a. ~ 275 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGM* |
Protein accession: | NP_006159 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.46 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NKX6-1 monoclonal antibody (M01), clone 1B7 Western Blot analysis of NKX6-1 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |