Cart 3 Product Products 1 072,78 € (empty)
No products
To be determined Shipping
1 072,78 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 072,78 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 072,78 €
Data sheet of NHS monoclonal antibody (M05), clone 6D9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about NHS monoclonal antibody (M05), clone 6D9
| Brand: | Abnova |
| Reference: | H00004810-M05 |
| Product name: | NHS monoclonal antibody (M05), clone 6D9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NHS. |
| Clone: | 6D9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4810 |
| Gene name: | NHS |
| Gene alias: | DKFZp781F2016|DKFZp781L0254|SCML1 |
| Gene description: | Nance-Horan syndrome (congenital cataracts and dental anomalies) |
| Genbank accession: | NM_198270 |
| Immunogen: | NHS (NP_938011.1, 1532 a.a. ~ 1629 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TAESPQSTDDAHQGSQGAEALSPLSPCSPRVNAEGFSSKSFATSASARVGRSRAPPAASSSRYSVRCRLYNTPMQAISEGETENSDGSPHDDRSSQSS |
| Protein accession: | NP_938011.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NHS is 0.03 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |