Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NHP2L1 monoclonal antibody (M02), clone 5C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about NHP2L1 monoclonal antibody (M02), clone 5C5
| Brand: | Abnova |
| Reference: | H00004809-M02 |
| Product name: | NHP2L1 monoclonal antibody (M02), clone 5C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NHP2L1. |
| Clone: | 5C5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4809 |
| Gene name: | NHP2L1 |
| Gene alias: | 15.5K|FA-1|FA1|NHPX|OTK27|SNRNP15-5|SNU13|SPAG12|SSFA1 |
| Gene description: | NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) |
| Genbank accession: | BC005358 |
| Immunogen: | NHP2L1 (AAH05358, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVI |
| Protein accession: | AAH05358 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NHP2L1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |