NHLH2 monoclonal antibody (M03), clone 3E11 View larger

NHLH2 monoclonal antibody (M03), clone 3E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NHLH2 monoclonal antibody (M03), clone 3E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about NHLH2 monoclonal antibody (M03), clone 3E11

Brand: Abnova
Reference: H00004808-M03
Product name: NHLH2 monoclonal antibody (M03), clone 3E11
Product description: Mouse monoclonal antibody raised against a full length recombinant NHLH2.
Clone: 3E11
Isotype: IgG2a Kappa
Gene id: 4808
Gene name: NHLH2
Gene alias: HEN2|KIAA0490|NSCL2|bHLHa34
Gene description: nescient helix loop helix 2
Genbank accession: NM_005599
Immunogen: NHLH2 (NP_005590, 36 a.a. ~ 135 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATR ERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
Protein accession: NP_005590
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004808-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004808-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NHLH2 is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NHLH2 monoclonal antibody (M03), clone 3E11 now

Add to cart