Brand: | Abnova |
Reference: | H00004808-M03 |
Product name: | NHLH2 monoclonal antibody (M03), clone 3E11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant NHLH2. |
Clone: | 3E11 |
Isotype: | IgG2a Kappa |
Gene id: | 4808 |
Gene name: | NHLH2 |
Gene alias: | HEN2|KIAA0490|NSCL2|bHLHa34 |
Gene description: | nescient helix loop helix 2 |
Genbank accession: | NM_005599 |
Immunogen: | NHLH2 (NP_005590, 36 a.a. ~ 135 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATR ERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV |
Protein accession: | NP_005590 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NHLH2 is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |