Brand: | Abnova |
Reference: | H00004804-M05 |
Product name: | NGFR monoclonal antibody (M05), clone 4G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NGFR. |
Clone: | 4G5 |
Isotype: | IgG1 Kappa |
Gene id: | 4804 |
Gene name: | NGFR |
Gene alias: | CD271|Gp80-LNGFR|TNFRSF16|p75(NTR)|p75NTR |
Gene description: | nerve growth factor receptor (TNFR superfamily, member 16) |
Genbank accession: | BC050309.1 |
Immunogen: | NGFR (AAH50309.1, 65 a.a. ~ 148 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
Immunogen sequence/protein sequence: | EPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEEGGGGS |
Protein accession: | AAH50309.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |