| Brand: | Abnova |
| Reference: | H00004804-M05 |
| Product name: | NGFR monoclonal antibody (M05), clone 4G5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NGFR. |
| Clone: | 4G5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4804 |
| Gene name: | NGFR |
| Gene alias: | CD271|Gp80-LNGFR|TNFRSF16|p75(NTR)|p75NTR |
| Gene description: | nerve growth factor receptor (TNFR superfamily, member 16) |
| Genbank accession: | BC050309.1 |
| Immunogen: | NGFR (AAH50309.1, 65 a.a. ~ 148 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
| Immunogen sequence/protein sequence: | EPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEEGGGGS |
| Protein accession: | AAH50309.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |