Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NGFR monoclonal antibody (M01), clone 1D1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about NGFR monoclonal antibody (M01), clone 1D1
| Brand: | Abnova |
| Reference: | H00004804-M01 |
| Product name: | NGFR monoclonal antibody (M01), clone 1D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NGFR. |
| Clone: | 1D1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4804 |
| Gene name: | NGFR |
| Gene alias: | CD271|Gp80-LNGFR|TNFRSF16|p75(NTR)|p75NTR |
| Gene description: | nerve growth factor receptor (TNFR superfamily, member 16) |
| Genbank accession: | BC050309.1 |
| Immunogen: | NGFR (AAH50309.1, 65 a.a. ~ 148 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
| Immunogen sequence/protein sequence: | EPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEEGGGGS |
| Protein accession: | AAH50309.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |