| Brand:  | Abnova | 
| Reference:  | H00004804-M01 | 
| Product name:  | NGFR monoclonal antibody (M01), clone 1D1 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant NGFR. | 
| Clone:  | 1D1 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 4804 | 
| Gene name:  | NGFR | 
| Gene alias:  | CD271|Gp80-LNGFR|TNFRSF16|p75(NTR)|p75NTR | 
| Gene description:  | nerve growth factor receptor (TNFR superfamily, member 16) | 
| Genbank accession:  | BC050309.1 | 
| Immunogen:  | NGFR (AAH50309.1, 65 a.a. ~ 148 a.a) partial recombinant protein with mouse IgG2a-Fc tag. | 
| Immunogen sequence/protein sequence:  | EPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEEGGGGS | 
| Protein accession:  | AAH50309.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA | 
| Shipping condition:  | Dry Ice |