Brand: | Abnova |
Reference: | H00004802-M01A |
Product name: | NFYC monoclonal antibody (M01A), clone 1D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NFYC. |
Clone: | 1D3 |
Isotype: | IgG1 Kappa |
Gene id: | 4802 |
Gene name: | NFYC |
Gene alias: | CBF-C|CBFC|DKFZp667G242|FLJ45775|H1TF2A|HAP5|HSM|NF-YC |
Gene description: | nuclear transcription factor Y, gamma |
Genbank accession: | BC005003.1 |
Immunogen: | NFYC (AAH05003.1, 14 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDF |
Protein accession: | AAH05003.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |