NFYC monoclonal antibody (M01A), clone 1D3 View larger

NFYC monoclonal antibody (M01A), clone 1D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NFYC monoclonal antibody (M01A), clone 1D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NFYC monoclonal antibody (M01A), clone 1D3

Brand: Abnova
Reference: H00004802-M01A
Product name: NFYC monoclonal antibody (M01A), clone 1D3
Product description: Mouse monoclonal antibody raised against a partial recombinant NFYC.
Clone: 1D3
Isotype: IgG1 Kappa
Gene id: 4802
Gene name: NFYC
Gene alias: CBF-C|CBFC|DKFZp667G242|FLJ45775|H1TF2A|HAP5|HSM|NF-YC
Gene description: nuclear transcription factor Y, gamma
Genbank accession: BC005003.1
Immunogen: NFYC (AAH05003.1, 14 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDF
Protein accession: AAH05003.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004802-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NFYC monoclonal antibody (M01A), clone 1D3 now

Add to cart