NFYC purified MaxPab rabbit polyclonal antibody (D01P) View larger

NFYC purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NFYC purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about NFYC purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004802-D01P
Product name: NFYC purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human NFYC protein.
Gene id: 4802
Gene name: NFYC
Gene alias: CBF-C|CBFC|DKFZp667G242|FLJ45775|H1TF2A|HAP5|HSM|NF-YC
Gene description: nuclear transcription factor Y, gamma
Genbank accession: NM_014223.2
Immunogen: NFYC (NP_055038.2, 1 a.a. ~ 335 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD
Protein accession: NP_055038.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00004802-D01P-13-15-1.jpg
Application image note: Western Blot analysis of NFYC expression in transfected 293T cell line (H00004802-T01) by NFYC MaxPab polyclonal antibody.

Lane 1: NFYC transfected lysate(37.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NFYC purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart