NFYA polyclonal antibody (A01) View larger

NFYA polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NFYA polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NFYA polyclonal antibody (A01)

Brand: Abnova
Reference: H00004800-A01
Product name: NFYA polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NFYA.
Gene id: 4800
Gene name: NFYA
Gene alias: CBF-A|CBF-B|FLJ11236|HAP2|NF-YA
Gene description: nuclear transcription factor Y, alpha
Genbank accession: BC039244
Immunogen: NFYA (AAH39244, 219 a.a. ~ 318 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: AIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
Protein accession: AAH39244
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004800-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NFYA polyclonal antibody (A01) now

Add to cart