Brand: | Abnova |
Reference: | H00004799-M01 |
Product name: | NFX1 monoclonal antibody (M01), clone 1D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NFX1. |
Clone: | 1D12 |
Isotype: | IgG2a Kappa |
Gene id: | 4799 |
Gene name: | NFX1 |
Gene alias: | DKFZp779G2416|MGC20369|NFX2 |
Gene description: | nuclear transcription factor, X-box binding 1 |
Genbank accession: | NM_002504 |
Immunogen: | NFX1 (NP_002495, 981 a.a. ~ 1080 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KFSDSLKEDARKDLKFVSDVEKEMETLVEAVNKGKNSKKSHSFPPMNRDHRRIIHDLAQVYGLESVSYDSEPKRNVVVTAIRGKSVCPPTTLTGVLEREM |
Protein accession: | NP_002495 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NFX1 monoclonal antibody (M01), clone 1D12 Western Blot analysis of NFX1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |