Brand: | Abnova |
Reference: | H00004794-M01 |
Product name: | NFKBIE monoclonal antibody (M01), clone 3F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NFKBIE. |
Clone: | 3F12 |
Isotype: | IgG2a Kappa |
Gene id: | 4794 |
Gene name: | NFKBIE |
Gene alias: | IKBE |
Gene description: | nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon |
Genbank accession: | NM_004556 |
Immunogen: | NFKBIE (NP_004547, 403 a.a. ~ 498 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SGKTALHLAVETQERGLVQFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEESLVLLPFDDLKISGKLLLC |
Protein accession: | NP_004547 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NFKBIE is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |