NFKBIB monoclonal antibody (M03), clone 3E11 View larger

NFKBIB monoclonal antibody (M03), clone 3E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NFKBIB monoclonal antibody (M03), clone 3E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about NFKBIB monoclonal antibody (M03), clone 3E11

Brand: Abnova
Reference: H00004793-M03
Product name: NFKBIB monoclonal antibody (M03), clone 3E11
Product description: Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Clone: 3E11
Isotype: IgG2a Kappa
Gene id: 4793
Gene name: NFKBIB
Gene alias: IKBB|TRIP9
Gene description: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta
Genbank accession: BC015528
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Protein accession: AAH15528
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004793-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004793-M03-1-2-1.jpg
Application image note: NFKBIB monoclonal antibody (M03), clone 3E11 Western Blot analysis of NFKBIB expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NFKBIB monoclonal antibody (M03), clone 3E11 now

Add to cart