| Brand: | Abnova |
| Reference: | H00004793-M02 |
| Product name: | NFKBIB monoclonal antibody (M02), clone 2B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NFKBIB. |
| Clone: | 2B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4793 |
| Gene name: | NFKBIB |
| Gene alias: | IKBB|TRIP9 |
| Gene description: | nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta |
| Genbank accession: | BC015528 |
| Immunogen: | NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA |
| Protein accession: | AAH15528 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NFKBIB monoclonal antibody (M02), clone 2B11 Western Blot analysis of NFKBIB expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |