NFKBIB monoclonal antibody (M01), clone 1B5 View larger

NFKBIB monoclonal antibody (M01), clone 1B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NFKBIB monoclonal antibody (M01), clone 1B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA

More info about NFKBIB monoclonal antibody (M01), clone 1B5

Brand: Abnova
Reference: H00004793-M01
Product name: NFKBIB monoclonal antibody (M01), clone 1B5
Product description: Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Clone: 1B5
Isotype: IgG2a Kappa
Gene id: 4793
Gene name: NFKBIB
Gene alias: IKBB|TRIP9
Gene description: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta
Genbank accession: BC015528
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Protein accession: AAH15528
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004793-M01-3-1-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to NFKBIB on formalin-fixed paraffin-embedded human lung. [antibody concentration 5 ug/ml]
Applications: IHC-P,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy NFKBIB monoclonal antibody (M01), clone 1B5 now

Add to cart