Brand: | Abnova |
Reference: | H00004793-M01 |
Product name: | NFKBIB monoclonal antibody (M01), clone 1B5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NFKBIB. |
Clone: | 1B5 |
Isotype: | IgG2a Kappa |
Gene id: | 4793 |
Gene name: | NFKBIB |
Gene alias: | IKBB|TRIP9 |
Gene description: | nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta |
Genbank accession: | BC015528 |
Immunogen: | NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA |
Protein accession: | AAH15528 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to NFKBIB on formalin-fixed paraffin-embedded human lung. [antibody concentration 5 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA |
Shipping condition: | Dry Ice |