Brand: | Abnova |
Reference: | H00004784-M08 |
Product name: | NFIX monoclonal antibody (M08), clone 3D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NFIX. |
Clone: | 3D2 |
Isotype: | IgG2a Kappa |
Gene id: | 4784 |
Gene name: | NFIX |
Gene alias: | NF1A |
Gene description: | nuclear factor I/X (CCAAT-binding transcription factor) |
Genbank accession: | NM_002501 |
Immunogen: | NFIX (NP_002492.2, 291 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR |
Protein accession: | NP_002492.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NFIX monoclonal antibody (M08), clone 3D2. Western Blot analysis of NFIX expression in Jurkat(Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |