| Brand: | Abnova |
| Reference: | H00004782-M04A |
| Product name: | NFIC monoclonal antibody (M04A), clone 2B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NFIC. |
| Clone: | 2B6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4782 |
| Gene name: | NFIC |
| Gene alias: | CTF|CTF5|MGC20153|NF-I|NFI |
| Gene description: | nuclear factor I/C (CCAAT-binding transcription factor) |
| Genbank accession: | NM_005597 |
| Immunogen: | NFIC (NP_005588, 314 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGP |
| Protein accession: | NP_005588 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NFIC monoclonal antibody (M04A), clone 2B6 Western Blot analysis of NFIC expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |