Brand: | Abnova |
Reference: | H00004782-M04 |
Product name: | NFIC monoclonal antibody (M04), clone 2B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NFIC. |
Clone: | 2B6 |
Isotype: | IgG1 Kappa |
Gene id: | 4782 |
Gene name: | NFIC |
Gene alias: | CTF|CTF5|MGC20153|NF-I|NFI |
Gene description: | nuclear factor I/C (CCAAT-binding transcription factor) |
Genbank accession: | NM_005597 |
Immunogen: | NFIC (NP_005588, 314 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGP |
Protein accession: | NP_005588 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NFIC monoclonal antibody (M04), clone 2B6 Western Blot analysis of NFIC expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |