| Brand:  | Abnova | 
| Reference:  | H00004780-M03 | 
| Product name:  | NFE2L2 monoclonal antibody (M03), clone 1B8 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant NFE2L2. | 
| Clone:  | 1B8 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 4780 | 
| Gene name:  | NFE2L2 | 
| Gene alias:  | NRF2 | 
| Gene description:  | nuclear factor (erythroid-derived 2)-like 2 | 
| Genbank accession:  | BC011558 | 
| Immunogen:  | NFE2L2 (AAH11558, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA | 
| Protein accession:  | AAH11558 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged NFE2L2 is approximately 0.1ng/ml as a capture antibody. | 
| Applications:  | IF,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Examining the endogenous antioxidant response through immunofluorescent analysis of Nrf2 in tissue.Lindl KA, Jordan-Sciutto KL. Methods Mol Biol. 2008;477:229-43. |