NFATC4 polyclonal antibody (A01) View larger

NFATC4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NFATC4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about NFATC4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00004776-A01
Product name: NFATC4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NFATC4.
Gene id: 4776
Gene name: NFATC4
Gene alias: NF-ATc4|NFAT3
Gene description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4
Genbank accession: NM_004554
Immunogen: NFATC4 (NP_004545, 613 a.a. ~ 715 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDF
Protein accession: NP_004545
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy NFATC4 polyclonal antibody (A01) now

Add to cart