| Brand:  | Abnova | 
| Reference:  | H00004773-M01A | 
| Product name:  | NFATC2 monoclonal antibody (M01A), clone 2A4 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant NFATC2. | 
| Clone:  | 2A4 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 4773 | 
| Gene name:  | NFATC2 | 
| Gene alias:  | KIAA0611|NFAT1|NFATP | 
| Gene description:  | nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 | 
| Genbank accession:  | NM_012340 | 
| Immunogen:  | NFATC2 (NP_036472, 812 a.a. ~ 921 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | HYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTRLSWIQNIL | 
| Protein accession:  | NP_036472 | 
| Storage buffer:  | In ascites fluid | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (37.84 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |