NFATC2 polyclonal antibody (A01) View larger

NFATC2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NFATC2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NFATC2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00004773-A01
Product name: NFATC2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NFATC2.
Gene id: 4773
Gene name: NFATC2
Gene alias: KIAA0611|NFAT1|NFATP
Gene description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
Genbank accession: NM_012340
Immunogen: NFATC2 (NP_036472, 812 a.a. ~ 921 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: HYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTRLSWIQNIL
Protein accession: NP_036472
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004773-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NFATC2 polyclonal antibody (A01) now

Add to cart