| Brand:  | Abnova | 
| Reference:  | H00004751-M02 | 
| Product name:  | NEK2 monoclonal antibody (M02), clone 2F9 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant NEK2. | 
| Clone:  | 2F9 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 4751 | 
| Gene name:  | NEK2 | 
| Gene alias:  | HsPK21|NEK2A|NLK1 | 
| Gene description:  | NIMA (never in mitosis gene a)-related kinase 2 | 
| Genbank accession:  | BC043502 | 
| Immunogen:  | NEK2 (AAH43502, 331 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR | 
| Protein accession:  | AAH43502 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (38.28 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human,Rat | 
| Application image:  |   | 
| Application image note:  | NEK2 monoclonal antibody (M02), clone 2F9 Western Blot analysis of NEK2 expression in PC-12 ( Cat # L012V1 ). | 
| Applications:  | WB-Ce,IF,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |