| Brand: | Abnova |
| Reference: | H00004751-M01 |
| Product name: | NEK2 monoclonal antibody (M01), clone 2F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NEK2. |
| Clone: | 2F6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4751 |
| Gene name: | NEK2 |
| Gene alias: | HsPK21|NEK2A|NLK1 |
| Gene description: | NIMA (never in mitosis gene a)-related kinase 2 |
| Genbank accession: | BC043502 |
| Immunogen: | NEK2 (AAH43502, 331 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR |
| Protein accession: | AAH43502 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to NEK2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |