Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NEDD9 monoclonal antibody (M01A), clone 1B4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about NEDD9 monoclonal antibody (M01A), clone 1B4
| Brand: | Abnova |
| Reference: | H00004739-M01A |
| Product name: | NEDD9 monoclonal antibody (M01A), clone 1B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NEDD9. |
| Clone: | 1B4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4739 |
| Gene name: | NEDD9 |
| Gene alias: | CAS-L|CAS2|CASL|CASS2|HEF1|dJ49G10.2|dJ761I2.1 |
| Gene description: | neural precursor cell expressed, developmentally down-regulated 9 |
| Genbank accession: | NM_006403 |
| Immunogen: | NEDD9 (NP_006394, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPV |
| Protein accession: | NP_006394 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NEDD9 expression in transfected 293T cell line by NEDD9 monoclonal antibody (M01A), clone 1B4. Lane 1: NEDD9 transfected lysate(92.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |