| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00004726-B01P |
| Product name: | NDUFS6 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NDUFS6 protein. |
| Gene id: | 4726 |
| Gene name: | NDUFS6 |
| Gene alias: | - |
| Gene description: | NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) |
| Genbank accession: | NM_004553.3 |
| Immunogen: | NDUFS6 (NP_004544.1, 1 a.a. ~ 124 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH |
| Protein accession: | NP_004544.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NDUFS6 expression in transfected 293T cell line (H00004726-T01) by NDUFS6 MaxPab polyclonal antibody. Lane 1: NDUFS6 transfected lysate(13.64 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Network Clustering Revealed the Systemic Alterations of Mitochondrial Protein Expression.Jeon J, Jeong JH, Baek JH, Koo HJ, Park WH, Yang JS, Yu MH, Kim S, Pak YK. PLoS Comput Biol. 2011 Jun;7(6):e1002093. Epub 2011 Jun 30. |