NDUFS3 purified MaxPab rabbit polyclonal antibody (D01P) View larger

NDUFS3 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFS3 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about NDUFS3 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004722-D01P
Product name: NDUFS3 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human NDUFS3 protein.
Gene id: 4722
Gene name: NDUFS3
Gene alias: -
Gene description: NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)
Genbank accession: NM_004551.1
Immunogen: NDUFS3 (NP_004542.1, 1 a.a. ~ 264 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
Protein accession: NP_004542.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00004722-D01P-2-C0-1.jpg
Application image note: NDUFS3 MaxPab rabbit polyclonal antibody. Western Blot analysis of NDUFS3 expression in mouse kidney.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NDUFS3 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart