Brand: | Abnova |
Reference: | H00004716-A01 |
Product name: | NDUFB10 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant NDUFB10. |
Gene id: | 4716 |
Gene name: | NDUFB10 |
Gene alias: | PDSW |
Gene description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa |
Genbank accession: | NM_004548 |
Immunogen: | NDUFB10 (NP_004539, 73 a.a. ~ 172 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS |
Protein accession: | NP_004539 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NDUFB10 polyclonal antibody (A01), Lot # 051122JC01. Western Blot analysis of NDUFB10 expression in Daoy. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |