NDUFB7 purified MaxPab mouse polyclonal antibody (B01P) View larger

NDUFB7 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFB7 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about NDUFB7 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004713-B01P
Product name: NDUFB7 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NDUFB7 protein.
Gene id: 4713
Gene name: NDUFB7
Gene alias: B18|CI-B18|MGC2480
Gene description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
Genbank accession: NM_004146.4
Immunogen: NDUFB7 (NP_004137.2, 1 a.a. ~ 137 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Protein accession: NP_004137.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004713-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NDUFB7 expression in transfected 293T cell line (H00004713-T01) by NDUFB7 MaxPab polyclonal antibody.

Lane 1: NDUFB7 transfected lysate(15.07 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NDUFB7 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart