No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00004712-D01P |
Product name: | NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human NDUFB6 protein. |
Gene id: | 4712 |
Gene name: | NDUFB6 |
Gene alias: | B17|CI|MGC13675 |
Gene description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa |
Genbank accession: | NM_002493.3 |
Immunogen: | NDUFB6 (NP_002484.1, 1 a.a. ~ 128 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH |
Protein accession: | NP_002484.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Western Blot analysis of NDUFB6 expression in transfected 293T cell line (H00004712-T01) by NDUFB6 MaxPab polyclonal antibody. Lane 1: NDUFB6 transfected lysate(15.50 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |