NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P) View larger

NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004712-D01P
Product name: NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human NDUFB6 protein.
Gene id: 4712
Gene name: NDUFB6
Gene alias: B17|CI|MGC13675
Gene description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
Genbank accession: NM_002493.3
Immunogen: NDUFB6 (NP_002484.1, 1 a.a. ~ 128 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
Protein accession: NP_002484.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00004712-D01P-13-15-1.jpg
Application image note: Western Blot analysis of NDUFB6 expression in transfected 293T cell line (H00004712-T01) by NDUFB6 MaxPab polyclonal antibody.

Lane 1: NDUFB6 transfected lysate(15.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart