NDUFB6 MaxPab rabbit polyclonal antibody (D01) View larger

NDUFB6 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFB6 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr,IP

More info about NDUFB6 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00004712-D01
Product name: NDUFB6 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human NDUFB6 protein.
Gene id: 4712
Gene name: NDUFB6
Gene alias: B17|CI|MGC13675
Gene description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
Genbank accession: NM_002493.3
Immunogen: NDUFB6 (NP_002484.1, 1 a.a. ~ 128 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
Protein accession: NP_002484.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00004712-D01-2-C0-1.jpg
Application image note: NDUFB6 MaxPab rabbit polyclonal antibody. Western Blot analysis of NDUFB6 expression in mouse kidney.
Applications: WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy NDUFB6 MaxPab rabbit polyclonal antibody (D01) now

Add to cart